Assignment 7 – DNA Modeling

Dean ZellerDue: Thursday, November 8th

CS1005110 points

Fall, 2007

Objective The student will create a structurally accurate model of an actual DNA strand out of pipe cleaners, and an accompanying report on the strand.

Website:

ncbi:National Center for Biotechnology Information

nlm:National Library of Medicine

nih:National Institutes of Health

Readings

Activity 7

Background: CoreNucleotide (DNA Sequence Database)

The National Center for Biotechnology Information maintains a web page of discovered DNA sequences in organisms. There is an intense amount of work by scientists to create these databases. We will use this database to find actual sequences of DNA to model.

Instructions

Follow these steps to create a DNA model:

1)Go to the NCBI website and select a DNA sequence to model.

  1. Go to the NCBI website.
  2. In the search text-box, enter the name of an organism, and click Go.
  3. Click the CoreNucleotide database.
  4. Find a DNA sequence that suits your needs. Check the source organism; your search term may be somewhere else in the report.

2)Create a report on your strand, following the template. Use copy and paste for report material. The report should be one page (two if necessary).

3)Create a model of a section of the DNA strand in the report. Choose a starting position in the DNA sequence, and work from there. You need not start at the beginning.

4)When complete with the model, boldface and outline the section included in the model and any other relevant information in the report.

Turning in your assignment
  • Make a printout of your report.
  • Turn in the model and the report.

Grading

You will be graded on the following criteria:

AccuracyCorrect representation of base pairs in the model

ReadabilityQuality of the report (complete, concise)

EffortQuantity, length, and quality of model created

Extra Credit

  • Length of model – 200 base pairs

DNA Modeling Report

Dean Zeller

CS10051

Search parameter: earthworm

Source:National Center for Biotechnology Information (

Model:Base Pairs 101 through 200

Report

LOCUS EU155485 342 bp mRNA linear INV 08-OCT-2007

DEFINITION Lumbricus terrestris gelsolin-related protein EWAM mRNA, partial

cds.

ACCESSION EU155485

VERSION EU155485.1 GI:157824625

KEYWORDS .

SOURCE Lumbricus terrestris(common earthworm)

ORGANISM Lumbricus terrestris

Eukaryota; Metazoa; Annelida; Clitellata; Oligochaeta; Haplotaxida;

Lumbricina; Lumbricidae; Lumbricus.

REFERENCE 1 (bases 1 to 342)

AUTHORS Krueger,E.M.I., Hinssen,H. and D'Haese,J.

TITLE A gelsolin-related protein involved in spermatogenesis of the

earthworm Lumbricus terrestris

JOURNAL Unpublished

REFERENCE 2 (bases 1 to 342)

AUTHORS Krueger,E.M.I. and D'Haese,J.

TITLE Direct Submission

JOURNAL Submitted (14-SEP-2007) Institut fuer Zoomorphologie, Zellbiologie

und Parasitologie, Heinrich-Heine Universitaet Duesseldorf,

Universitaetsstr. 1, Duesseldorf 40225, Germany

FEATURES Location/Qualifiers

source 1..342

/organism="Lumbricus terrestris"

/mol_type="mRNA"

/db_xref="taxon:6398"

/sex="male"

/cell_type="germ cells"

/tissue_type="seminal vesicle"

CDS <1..>342

/note="similar to gelsolin-related protein EWAM isoform P1

from muscle in GenBank Accession Number D29920"

/codon_start=1

/product="gelsolin-related protein EWAM"

/protein_id="ABV82435.1"

/db_xref="GI:157824626"

/translation="VNFKVTEWPQNQHGKFYNGDSYIILNTYKPDPKSNELAYDVHFW

IGSQSSQDEYGTAAYKTVELDTFLDDKPVQHREVQGYESELFRNYFKQGLTILEGGAE

TGFHHVKPTEYK"

ORIGIN

1 gtgaatttca aggtgactga atggccacag aaccaacacg gaaagttcta caacggagat

61 tcctacatca ttctaaacac gtacaagccg gacccgaaga gcaatgaact ggcctatgac

121 gttcacttct ggattggcag tcaaagttcc caggatgagt atggaacggc tgcgtacaag

181 acggtggagc tggatacgtt ccttgacgac aaaccagttc aacatcgcga ggtccaaggt

241 tacgagtcgg aactcttccg aaactacttc aagcaaggac tgacgatcct tgagggtgga

301 gctgagactg gattccacca cgtgaaacca acggaataca aa