IAAP CertifiedProfessionalin
AccessibilityCoreCompetencies(CPACC)
Body of Knowledge (BOK)
2017 Editor:
●Valorie Sundby
Contributors:
●Rocio Calvo
●Pina D’Intino
●Samantha Evans
●KatieHaritos-Shea
●SusanHewitt
●Allen Hoffman
●Shilpi Kapoor
●Susanna Laurin
●Damian Sian
●Stacy Straczynski
●DavidWysocki
May 30, 2017
Table of Contents
IAAP CertifiedProfessionalin
AccessibilityCoreCompetencies(CPACC)
Body of Knowledge (BOK)
ThePurposeofthisDocument
IAAPExamPreparationResources
AbouttheCPACCCredential
TheCPACCExamContentataGlance
AdditionalInformation
I:Disabilities,Challenges,andAssistive
A.TheoreticalModelsofDisability
1.MedicalModel
2.SocialModel
3.EconomicModel
4.FunctionalSolutionsModel
5.SocialIdentityorCulturalAffiliationModel
Resources
B.CharacteristicsandCategoriesofDisabilities,Challenges,IncludingAssociatedBarriers
GeneralResources
1.Vision
2.AuditoryDisabilities
3.Deafblindness
4.Mobility,Flexibility,andBodyStructureDisabilities
5.CognitiveDisabilities
6.SpeechDisabilities
7.Seizures
8.PsychologicalorPsychiatricDisabilities
9.Multiple/CompoundDisabilities
Resources
C.AssistiveTechnologiesandAdaptiveStrategiesattheLeveloftheIndividualforPermanent,Temporary,andEpisodicDisabilities(ICTandPhysicalWorld)
1.VisualDisabilitiesAssistiveTechnologies
2.DeafblindnessAssistiveTechnologyandAdaptiveStrategies Resources
3.AuditoryDisabilitiesAssistiveTechnologyandAdaptiveStrategies Resources
4.MobilityandDexterityDisabilitiesAssistiveTechnologiesandAdaptiveStrategies
5.CognitiveDisabilitiesAssistiveTechnologiesandAdaptiveStrategies
6.SpeechDisabilitiesAssistiveTechnologiesandAdaptiveStrategies
7.SeizureDisabilitiesAssistiveTechnologiesandAdaptiveStrategies
8.Multiple/CompoundDisabilitiesAssistiveTechnologiesandAdaptiveStrategies
Resources
B.DisabilityEtiquette
Resources
II.AccessibilityandUniversalDesign
A.IndividualAccommodationsversusInclusiveDesign
B.BenefitsofAccessibility
1.BenefitsforPeoplewithDisabilitiesandtheirFamilies
2.BenefitsforSociety
3.BenefitsforBusinesses
C.AccessibilityPrinciplesforICT(WCAG2.0)
D.AccessibilityPrinciplesforthePhysicalWorld(UniversalDesign2.0)
1.EquitableUse
2.FlexibilityinUse
3.SimpleandIntuitiveUse
4.PerceptibleInformation
5.ToleranceforError
6.LowPhysicalEffort
7.SizeandSpaceforApproachandUse
Resources
E.UniversalDesignforLearning(UDL)
1.ProvideMultipleMeansofEngagement
2.ProvideMultipleMeansofRepresentation
3.ProvideMultipleMeansofActionandExpression
Resources
F.UsabilityandUserExperience(UX)
III.Laws,Regulations,Standards,Policies,andOrganizationalAccessibilityStrategies
A.InternationalConventionsandTreatiesonDisabilityRights
1.TheUniversalDeclarationofHumanRights
2.ConventionontheRightsofPersonswithDisabilities
B.CategoriesofDisabilityLawsandRegulations
C.ApplyingAccessibilityStandardsandRegulations
D.Integrating Accessibility Across Your Organization
1.Management Champions
2.Accessibility: An Organization-wide Process Not A Project
4.Recruiting, Hiring, & Accessibility Competencies
5.CommunicationManagement Strategies
6.Legal & PR Implications
7.Procurement Processes
8.Stakeholders and Influencers
ThePurposeofthisDocument
ThisBodyofKnowledgedocumentoutlinestheknowledgeandskillsexpectedofcandidatesseekingtoobtaintheCertifiedProfessionalinAccessibilityCoreCompetencies(CPACC)credential.Specifically,thethreemainpurposesofthisdocumentareasfollows:
1.Listthecategoriesofinformationcoveredintheexam
2.Presentgeneralinformationabouteachcategory
3.Listadditionalresourcestohelptesttakerspreparefortheexam
TheBodyofKnowledgeisdesignedtobea startingpointwhenstudyingfortheCPACCexam.Itisnotintendedtobeanexhaustiveexplanationofeveryconceptorquestionontheexam.Please note that the use of this guide does not guarantee successful completion of the exam.
If you discover any broken links, please contact .
IAAPExamPreparationResources
Test-takerscanstudyresourcesavailableanywhereinpreparationfortheexam.IAAP lists a collection of CPACC resources for preparation that are both free and for purchase. You can find these resources on the IAAP Prepare for the CPACC Exam webpage.
TheIAAPalsomaintainsalistofIAAP-approvedexampreparationprovidersatIAAPCertificationProviders.AtthetimethisBodyofKnowledgewaspublished,thelistconsistedofthefollowing:
●DequeUniversity CPACC Course:
●SSBUniversity:
AbouttheCPACCCredential
TheCertifiedProfessionalinAccessibilityCoreCompetencies(CPACC)credentialisIAAP'sfoundationalcertification,representingthepracticalapplicationofbroad,cross-disciplinaryconceptualknowledgeabout1)disabilities,2)accessibilityanduniversaldesign,and3)accessibility-relatedstandards,laws,andmanagementstrategies.RelevantdomainsfortheCPACCcredentialinclude:
●thewebandotherdigitaltechnologies
●architectureandthebuiltenvironment
●consumerandindustrialdesign
●transportationsystems
●anydomaininwhichthoughtfuldesign,policy,andmanagementcanimprovedisabilityaccess
TheCPACCcanbeconsideredthebaselineIAAPcredentialfornon-technicalaccessibilityroles.Forthosewhodoworkatthetechnicallevel,IAAPis also offering the Web Accessibility Specialist (WAS) designation in addition to the CPACCcredential.Individuals who pass the Certified Professional in Accessibility Core Competencies (CPACC) and the Web Accessibility Specialist (WAS) exams are eligible to carry a higher level credential called the Certified Professional in Web Accessibility (CPWA).TheIAAPhas plans to grow their domain specific designation offerings and willannouncewhenthoseadditionalcertificationexamsareavailabletothepublic.
TheCPACCExamContentataGlance
I.Disabilities, Challenges and Assistive Technologies (40% of the exam)
A. Theoretical Models of Disability
B. Categories of Disabilities and Associated Barriers (ICT and Physical World)
C.Assistive Technologies and Adaptive Strategies
D.Disability Demographics and Statistics
E.Disability Etiquette
II.Accessibility and Universal Design (40% of the exam)
- Individual Accommodations versus Inclusive Design
- Benefits of Accessibility
- Accessibility in ICT (WCAG 2.0)
- Accessibility in the Physical World (The Principles of Universal Design 2.0)
- Universal Design for Learning (UDL)
- Accessibility and Usability/User Experience (UX)
II.Declaration, Standards, Laws, and Management Strategies (20% of the exam)
- International Conventions and Treaties on Disability Rights
- Categories of Disability Laws and Regulations
- Applying Accessibility Standards and Regulations
- Organizational Governance and Management
AdditionalInformation
●IAAPmain website
●GeneralinformationaboutIAAPcertification
●CPACCExamContentOutline
●CPACCFrequently-AskedQuestions
●CPACC Preparation Resources
●IAAP-ApprovedCertificationPreparationProviders
●IAAP webpage: Processofcreatingaprofessionalcertification
I:Disabilities,Challenges,andAssistive
Technologies
A.TheoreticalModelsofDisability
Recommendedstudytasks:
1.Characterizeanddifferentiatebetweentheoreticalmodelsofdisability,includingthestrengthsandweaknessesoftheirunderlyingassumptions
2.Identifythenames,terminology,andbasicconceptsofprominenttheoreticalmodelsofdisability.
3.Compareandcontrasttheunderlyingassumptionsofthedifferentmodels.
4.Comparetheimplicationsofeachmodelonpublicandpersonalperceptionsofdisability.
5.Evaluatethestrengthsandweaknessesofeachmodel
6.Demonstrateanunderstandingofwhichmodelsalignmostcloselywiththeprinciplesofaccessibilityanduniversaldesign.
7.Demonstrateanunderstandingofwaysinwhichvariousmodelsmayoverlaporcomplementeachother.
8.Applythemodelstoexamplescenariosinthelivesofpeoplewithdisabilities.
1.MedicalModel
DefinitionoftheMedicalModel:
FromDisabledWorld:
Themedicalmodelispresentedasviewingdisabilityasaproblemoftheperson,directlycausedbydisease,trauma,orotherhealthconditionwhichthereforerequiressustainedmedicalcareprovidedintheformofindividualtreatmentbyprofessionals.Inthemedicalmodel,managementofthedisabilityisaimedata"cure,"ortheindividual’sadjustmentandbehavioralchangethatwouldleadtoan"almost-cure"oreffectivecure.Inthemedicalmodel,medicalcareisviewedasthe mainissue,andatthe politicallevel,theprincipalresponse isthat ofmodifyingorreforminghealthcarepolicy.
DisabledWorld:DisabilityModels
FromWikipedia:
Themedicalmodelofdisability isa sociopoliticalmodelby whichillnessordisability,beingthe resultofaphysicalconditionintrinsictothe individual(itispartofthatindividual’sownbody),mayreducetheindividual'squalityoflife,andcausecleardisadvantagestotheindividual.Themedicalmodeltendstobelievethatcuringoratleastmanagingillnessordisabilitymostlyorcompletelyrevolvesaroundidentifyingtheillnessordisabilityfromanin-depthclinicalperspective(inthesenseofthescientificunderstandingundertakenbytrainedhealthcareproviders),understandingit,andlearningtocontroland/oralterits
course.Byextension,themedicalmodelalsobelievesthata"compassionate"orjustsocietyinvestsresourcesinhealthcareandrelatedservicesinanattempttocuredisabilitiesmedically,toexpandfunctionalityand/orimprovefunctioning,andtoallow disabledpersonsamore"normal"life.Themedicalprofession'sresponsibilityandpotentialinthisareaisseenascentral.
Wikipedia:Medicalmodelofdisability
StrengthsoftheMedicalModel:
Themedicalmodelcanaddressthebiologicalsourcesofdisabilities,eitherbyclinicallycuringthemorprovidingwaystomedicallymanagetheconditions.The medicalcomponentofdisabilitiesisa criticalreality formany people.
WeaknessesoftheMedicalModel:
Themedicalmodeltreatsdisabilityasa"problem"orinherentcharacteristicoftheindividual,andseekscuresormedicalmanagementofabodilycondition,oftenoverlookingthebroadersociopoliticalconstraintsimposedbyunwelcomingorinaccessibleenvironments.
RecoursesoftheMedicalModel:
DisabilityandSociety:IndependentLivingandtheMedicalModelofDisabilityDisabledWorld:DisabilityModels
UniversityofLeicester:Thesocialandmedicalmodelofdisability
DisabilityNottinghamshireOrgUKTheSocialModelvsTheMedicalModelofDisabilityWikipedia:Medicalmodelofdisability
2.SocialModel
DefinitionoftheSocialModel:
FromDisabledWorld:
Thesocialmodelofdisability seesthe issueof"disability"asa sociallycreatedproblemandamatterofthefullintegrationofindividualsintosociety.Inthismodel,disability isnot anattributeofanindividual,butrather a complexcollectionofconditions, manyofwhicharecreatedbythesocialenvironment.Hence,themanagementoftheproblemrequiressocialactionandisthecollectiveresponsibilityofsocietyatlargetomaketheenvironmentalmodificationsnecessaryforthe fullparticipationofpeople withdisabilitiesinallareasofsocial life.The issue isbothculturalandideological,requiringindividual,community,andlarge-scalesocialchange.Fromthisperspective,equalaccessforsomeonewithanimpairment/disabilityisahumanrightsissueofmajorconcern.
DisabledWorld:DisabilityModels
FromWikipedia:
Thesocialmodelofdisability isareactiontothe dominantmedicalmodelofdisability whichinitselfisa functionalanalysisofthebodyasmachinetobefixedinordertoconformwithnormative values.Thesocialmodelofdisabilityidentifiessystemicbarriers,negativeattitudesandexclusionbysociety(purposelyorinadvertently)thatmeansocietyisthemaincontributoryfactorindisablingpeople.Whilephysical,sensory,intellectual,orpsychologicalvariationsmaycauseindividualfunctionallimitationorimpairments,thesedonot havetoleadtodisability unlesssociety failstotakeaccountofandincludepeopleregardlessoftheirindividualdifferences.Theoriginsoftheapproachcanbetracedtothe1960s;thespecifictermemergedfromtheUnitedKingdominthe1980s.
Thesocialmodelofdisabilityhascometobeoneofthemostprevalentapproachestodisability,andhasbecomesomewhatofarallyingcryfordisabilityadvocatesfromasocialjusticeperspective.
Wikipedia:Socialmodelofdisability
StrengthsoftheSocialModel:
Thesocialmodel'sfocusonthedisablingconditionsintheenvironmentandinsocietymakesitclearthatthebarriersandchallengesexperiencedbypeoplewithdisabilitiesarenotinevitable,noraretheyexclusivelyacharacteristicoftheindividual's"broken"body.Societiescanimprovethelivesofpeoplewithdisabilitiesconsiderablybyensuringthattheworldaroundusisdesignedtoaccommodateawiderangeofhumancharacteristicsandabilities.
WeaknessesoftheSocialModel:
Thesocialmodelofdisabilitycantendtodownplaytheembodiedaspectsofdisabilitiestoomuch,asifdisabilityhadnothingtodowith bodily characteristicsatall.The socialmodel'spushfor socialjustice inthepoliticalarena canalsoputactivistsatoddswithpeoplewithotherpoliticalinterests,antagonizingrelationshipsandsometimescreatingresolutepoliticaladversaries.
ResourcesoftheSocialModel:
DisabilityNottinghamshire:TheSocialModelvsTheMedicalModelofDisabilityUniversityofLeicester:Thesocialandmedicalmodelofdisability
DisabledWorld:DisabilityModelsWikipedia:Socialmodelofdisability
3.EconomicModel
DefinitionoftheEconomicModel:
FromDisabledWorld:
Definesdisabilitybyaperson’sinabilitytoparticipateinwork.Italsoassessesthedegreetowhichimpairmentaffectsanindividual’sproductivityandtheeconomicconsequencesfortheindividual,employerandthestate.Suchconsequencesincludelossofearningsfor andpaymentforassistanceby theindividual;lowerprofitmarginsfortheemployer;andstatewelfarepayments.Thismodelisdirectlyrelatedtothecharity/tragedymodel.
DisabledWorld:DisabilityModels
StrengthsoftheEconomicModel:
Theeconomicmodelrecognizestheeffectofbodilylimitationsonaperson’sabilitytowork,andtheremaybeaneedforeconomicsupportand/oraccommodationsfortheperson’sdisability.
WeaknessesoftheEconomicModel:
Theeconomicmodelcreatesalegally-definedcategoryofpeoplewhoare“needy,”whichcanbestigmatizingforpeoplewithdisabilities.Also,ifapersondoesn’tmeetthelegalthresholdfor“disabled,” or ifthere isadispute astoa person’sdisability,thepersonwiththedisabilitymaynotreceivethesupporttheyneed.
ResourcesoftheEconomicModel:
DisabledWorld:DisabilityModels
MichiganDisabilityRightsCoalition: ModelsofDisability
4.FunctionalSolutionsModel
DefinitionoftheFunctionalSolutionsModel:
Thefunctionalsolutionsmodelofdisabilityisapracticalperspectivethatidentifiesthelimitations(or"functionalimpairments")duetodisability,withtheintenttocreateandpromotesolutionstoovercomethoselimitations.Theprimarytaskistoeliminate,oratleastreduce,theimpactofthefunctionallimitationsofthebodythroughtechnologicalormethodologicalinnovation.Thepragmatismofthefunctionalsolutionmodeldeemphasizesthesociopoliticalaspectsofdisability,andinsteadprioritizesinventivenessandentrepreneurship.
StrengthsoftheFunctionalSolutionsModel:
Thestrongestaspectofthismodelisthatitisresults-oriented.Itseekstoprovidesolutionstoreal-worldchallenges,whilesidesteppingtheoftenconvolutedsociopoliticalimplicationsofdisability withinsociety.
WeaknessesoftheFunctionalSolutionsModel:
Whennewtechnologiesareinvolved,profit-drivenentrepreneurscansometimesmissthemark,creatingproductsthatmaybeinnovativebutnotpracticaloruseful,orwhichmaybeofmorebenefittotheinnovatorsthantothetargetpopulation,especiallyiftheproposedsolutionsareexpensive.Also,whentheprimarycauseofaparticularchallengeisthesocioeconomiccircumstancesintheenvironment,thefunctionalsolutionsmodel'sde-emphasisonsocioeconomicissuescancausewould-beinnovatorstoignorethemostimportantaspectsoftheoriginalproblem.
ResourcesoftheFunctionalSolutionsModel:
MartyCooper:ModelsofDisabilityandAccessibility
5.SocialIdentityorCulturalAffiliationModel
DefinitionoftheSocialIdentityorCulturalAffiliationModel:
Thesocialidentityorculturalaffiliationmodelreferstoasenseofderivingone'spersonalidentityfrommembershipwithinagroupoflike-mindedindividuals.Thismodelismostevidentamongpeoplewhoaredeaf,becauseoftheirsharedlinguisticexperienceassignlanguageusers.Deafcultureandidentityowesmuchofitsstrengthtothesomewhatexclusivenatureofbeingapartofaclose-knitlinguisticminority.
Otherpeoplewithdisabilitiesmayalsofeelasenseofbelongingtoacommunitywithcommonlifeexperiencesandinterests.
StrengthsoftheSocialIdentityorCulturalAffiliationModel:
Thesocialidentityorculturalaffiliationmodelacceptstheperson'sdisabilitycompletely,andusesitasa point ofpride inbeingassociatedwithotherpeople inasimilar condition.
WeaknessesoftheSocialIdentityorCulturalAffiliationModel:
Sometimesthesenseofbelongingfeltbyonegroupofpeopleiscounterbalancedbyasenseofexclusionandnotbelongingby peoplewhodon't quitefitthegroup'sexpectations.
ResourcesoftheSocialIdentityorCulturalAffiliationModel:
6.CharityModel
DefinitionoftheCharityModel:
Thecharitymodelregardspeoplewithdisabilitiesasunfortunateandinneedofassistancefromtheoutside,withthoseprovidingcharityviewedasbenevolentcontributorstoaneedypopulation.
StrengthsoftheCharityModel:
Thecharitymodelcaninspirepeopletocontributetheirtimeand/orresourcestoprovideassistancewhenitisgenuinelyneeded.
WeaknessesoftheCharityModel:
Thecharitymodelcanbecondescendingtowardpeoplewithdisabilities,whomaycometoresentthefeelingthattheyaretheobjectofpitybyotherpeople,andthattheymustdependonacceptingorcultivatingthispityona continualbasis.Thecharitymodeloftenfocusesonshort-term,immediateneeds,oftenattheexpenseofmorecomprehensive,andultimatelymoreeffective,long-termsolutions.
Resources
MichiganDisabilityRightsCoalition: ModelsofDisability
NCBI:USSurgeonGeneral’sCalltoActiontoImprovetheHealthandWellnessofPersonswith Disabilities
B.CharacteristicsandCategoriesofDisabilities,Challenges,IncludingAssociatedBarriers
GeneralResources
DisabilityBenefitsHelp:DisablingConditions
Gov.UK:EqualityAct2010GuidancepdfDisabilityWorld:TypesofDisabilities
DequeUniversity:Sensorydisability
WorldHealthOrganization:Factsheet
RecommendedStudyTasks:
●Namethemaincategoriesofdisabilities.
●Classifyspecificconditionsundertheirrelevantdisabilitycategoryorcategories.
●Defineassistivetechnologies.
●Matchdisabilitycategorieswithrelevantassistivetechnologies.
●Describetheaccessibilitychallengesfacedbypeoplewithdisabilitiesofagivencategory.
●Givenascenarioornarrativeinanapplieddomain,identifyaccessibilitychallengesforpeopleofvariouskindsofdisabilities,andpotentialsolutionstoovercome thosechallenges.
●Ratetheappropriatenessofaproposedsolutionfor apersonwitha specificdisability.
1.Vision
ColorBlindness
Definition:Color-blindnessisasensorydisabilitythatimpairsaperson'sabilitytodistinguishcertaincolorcombinations.
Characteristics:Themostcommonformsofcolor-blindnessaffectanindividual'sabilitytodistinguishredsandgreens,thoughothercolorsmaybeaffected.
Demographics:Mostcolor-blindnessresultsfromasex-linkedgenetictrait,thusaffectingmalesandfemalesdifferently.About8% ofmaleshavesomeformofcolor-blindness,comparedtoabout0.4%offemales.
AssistiveTechnologiesandMethods:Filteredglasses,filteredoverlaysonprintedorelectronictext.
Color-Blindness:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
Domain / Challenges / SolutionsGeneral / Certaincolorcombinations--redandgreeninparticular--canbedifficulttodistinguish / Materialscanbedesignedinawaythatdoesnotdependoncolorasawaytoconveyinformation.
Blindness
Definition:Blindnessisasensorydisabilityinvolvingnearlycompletevisionloss.
Characteristics:Somepeoplearecompletelyblind,withouttheabilitytoseeanything.Otherscanperceivelightversusdark,orthegeneralshapesoflargeobjects,butcannotreadtextorrecognizepeoplebysight.
Demographics:About39millionpeople,orabout0.5%oftheworld'spopulation,areblind, accordingtotheWorldHealthOrganization.About90%ofpeoplewithvisualimpairmentsliveinlowincome settings,andabout82%ofpeoplewhoareblindare aged50andabove.
AssistiveTechnologiesandMethods:Screenreaderswithaudioand/orBrailleoutputforcomputeraccess,canesorserviceanimals(suchas"seeingeye"dogs)formobility.
Blindness:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
Domain / Challenges / SolutionsICT / Cannotseedigitalorelectronicinterfaces(computers,automatedtellermachines(ATMs),mobiledevices,airportkiosks,televisions,printers,copiers,phones,GPSdevices,etc.) / Screenreaderscanreadinterfacesandcontentout loudtousersbyconvertingdigitaltexttosynthesizedspeech,butonlyiftheyhavebeendesignedtobeaccessible.
Self-voicinginterfacesandapplicationscancommunicatetouserswithouttheneedforascreenreader,buttheseareappropriatemostlyforbroadcastinginformation,becausetheyusuallydonotuseorinteractwiththeinterfaceorcontentasscreenreadersdo.Refreshable Braille output devices use screen readers to convert digital text to Braille. These devices are typically expensive, and only a minority of blind people know how to read Braille.
ICT / Cannotusescreenreadersondigitalcontentandinterfacesnotdesignedwithaccessibilityinmind / Interfacedesignersandcontentauthorscaneditthemarkuptomakeitcompatiblewiththeassistivetechnologiesusedbyblindpeople.
ArchitectureBuiltEnvironment / Cannotseewhenwalking / Caneshelpblindpeoplefeeltheirsurroundingsastheywalk.
Serviceanimals(e.g."SeeingEye"dogs),trainedtoassistblindpeople,helpthemnavigatetheirsurroundings.
GPS-basedwalkinginstructionswithanaudiointerface,eitherautomatedorviaaremotehumannavigator.
Raisedtilesonthegroundtoindicatetheedgeofaplatform,apathwayalongasidewalk,thebeginningofastaircase,etc.Eliminatelow-hangingarchitecturalfeaturesthata blindpersoncouldbumpinto
Clearpathwayswithoutobstructions inhallways,sidewalks.
ArchitectureBuiltEnvironment / Cannotseesignsor othertextonbuildingsor otherareasinthebuiltenvironment / Mapandgeolocationapplicationsonmobiledevicescanannouncethenamesanddescriptionsofbuildingsandotherlocation-relatedinformation.
Braillelabelsanddescriptionson entrances,rooms,bathrooms,historicalmarkers,andotherpointsofinterestcanallowblindpeopletoexploreandunderstandtheirsurroundings,aslongasthe personknowsBraille,andaslongasthe Braillelabelsare easytofind.
Tactilemodelsoftheexteriorofbuildings,oroffloorplansoftheinteriorofbuildingshelpblindpeople forma mentalmapoftheirsurroundings.
Domain / Challenges / Solutions
ConsumerIndustrialProducts / Cannotseeorfeelthecontrolsonflatinterfacesonconsumerdevicessuchasmicrowaves,ovens,dishwashers,etc. / Alternativeinterfaceswithknobsorothertactilecontrols
Audiointerfaces
Remotecontrolthroughapplicationson mobile devices.
ConsumerIndustrialProducts / Cannotreadthetextonthecontainersorpackagingforconsumeritemssuchasmedicine,toothpaste,shampoo,sunscreen,handcream,personalcareproducts,foods,drinks,candy / EmbossedBraille(orBraille stickers)onpackagingandproductcontainershelpconsumersidentifyitemsbothinthestoreandafterpurchase.
ConsumerIndustrialProducts / Cannotreadmoneytodetermineitsvalue / Applicationsonmobile devicescanphotographthemoneyandreadthevaluetoblindpeople.
Paperbillsandcoinscouldbemanufacturedindifferentsizes,shapes,ortexturestoallowblindpeopletodistinguishthevalue basedontouch.
Non-cachesystemsofpaymentcanallowblindpeopletomakefinancialtransactionsviacomputers,mobiledevices,oron-sitepaymenthardwarewithscreenreadersorself-voicingoutput.
ConsumerIndustrialProducts / Cannotreadbooks,magazines,posters,postalmail,orotherprintedmaterials / Opticalcharacterrecognitionsoftwarecanconvertscannedimagesoftextintodigitaltextreadablebyscreenreaders.Theaccuracyoftheconversiondependsonthequalityoftheoriginaldocument,aswellasfontchoices,linespacing,andthequalityoftheconversionsoftwareitself.
Informationcanbeplacedonlineorinotherdigitalformatstoallow blindpeople toreadthematerialsusingtheirownassistivetechnologies.
LowVision
Definition:Lowvisionisasensorydisabilitythatimpairsa person'svisiontothepoint thatcorrectivelensescannotrestorefullvisualacuity,buttheimpairmentisnotassevereastobeclassifiedasblindness.The thresholdfor classificationaslowvisionis usually designatedasacorrectedvisualacuityofnobetterthan20/40or20/60.
Characteristics:Apersonwithlowvisionwilltypicallyneedmagnificationtoseewellenoughtoreadordiscernotherdetails.Somepeoplewithlowvisionexperiencelowcontrast,andthereforebenefitfromhighcontrasttextandgraphics.Someexperiencecolordeficiencies,whichmeanstheymaynotbeabletoseethedifferencebetweencertaincolors.
Demographics:About246millionpeople,or3.5%oftheworld'spopulation,havelowvision, accordingtotheWorldHealthOrganization.About90%ofpeoplewithvisionimpairmentsliveinlowincomesettings.
AssistiveTechnologiesandMethods:Screenmagnifiers,screenreaders,increasecontrast,increasesizeofmousepointerandkeyboardcaret.
LowVision:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
Domain / Challenges / SolutionsGeneral / Smalltextcanbehardtoread. / Screenmagnifierscanenlargetheitemsonthescreentomakethemeasiertoread.
Utilitiestoenhancecontrast,changecolors,oralterotheraspectsofvisualappearancecanimprovelegibility.
Screenreaderscansupplementscreenmagnifiersbyreadinginterfacesandcontentoutloudtousersthroughsynthesizedspeech,butonlyifthedigitalinformationhasbeendesignedtobeaccessible.Self-voicinginterfaces(onATMs,kiosks,transportationsystems,etc.)andapplicationscancommunicatetouserswithouttheneedforascreenreader,buttheseareappropriatemostlyforbroadcastinginformation,becausetheyusuallydonotuseorinteractwiththeinterfaceorcontentasscreenreadersdo.
Alternativelargeprintversionsofsmallprinttextcanmakeprintedmaterialseasiertoread.
Alternativedigitalversions(web,mobileapplications,etc.)ofprintedmaterialscangiveuserstheabilitytoreadthematerialsusingtheirownassistivetechnologies.
General / Lowcontrasttextcanbehardtoread. / Softwareorhardwareoptionscanenhancethecontrastofdigitaltext.Interfacedesignersandcontentcreatorscanchoosecolorcombinationswithhighenoughcontrasttoeasilyread
2.AuditoryDisabilities
Deafness
Definition:Auditorydisabilitiesaresensorydisabilitiesthatcanbecategorizedaseitherdeafnessorhardofhearing.Deafnessisthetotalorneartotallossofhearing.Individualswhoarehardofhearinghavepartially-impairedhearinginoneorbothears.
Characteristics:Apersonwhoisdeafor hardofhearingwillhavedifficultywithsounds,includingtheaudiocomponentofmultimediamaterials.Many,butnotall,peoplewhoaredeafknowsignlanguage.Oftensignlanguageisthefirstlanguage—andthereforethemostcomfortablenativelanguage—ofthosewhoareborndeaf.Theymayfeellesscomfortablereadingprintedordigitaltext.Bywayofcontrast,thosewholosetheirhearinglaterinlifemay
neverlearnsignlanguage,oriftheylearnit,theymaynotfeelascomfortablespeakinginsign,andmayprefertext.
Demographics:Approximately15%ofadultshavesomedegreeofhearingloss.About2%ofadultsaged45to54havedisablinghearingloss.Thispercentageincreasesto8.5% for adultsbetween55and64,25% foradultsbetween65and74,and50%foradults75andolder.(AccordingtoNationalInstituteonDeafnessOtherCommunicativeDisordersintheU.S.)
AssistiveTechnologiesandMethods:Hearingaids,cochlearimplants,captionsforvideos,transcriptsforvideooraudio,signlanguageinterpretation.
Color-BlindnessandICT:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
Domain / Challenges / SolutionsICT / Theaudioportionofvideoscannotbeheard / Providesynchronizedcaptionswithvideos
Providesignlanguageinterpretation
Provide a transcript
General / Speechesandtalkscannotbeheardbydeafpeopleintheroom / ProvidesignlanguageinterpretationProvidelivecaptionsona monitorduringthespeech
ArchitectureandtheBuiltEnvironment / Doorbells,alarms,andothersoundsmay notbeheard / Providealternativevisualalerts,suchaslightsthatflash,pulse,dim,turnon,orturnoff.
- HardofHearing
- Understood.orgDifferenceBetweenAuditoryProcessingDisorderandBeingHardofHearing
EllenKoslo,AssociateProfessorofOtolaryngology,ColumbiaUniversityMedicalCenter
“Hearingloss,orhearingimpairment,isaproblemwithoneormorepartsoftheearthatinterruptsthewaysoundtravelsthroughthehearingsystemuptothebrain.Someonewhohashearinglossmightbeabletohearmostsounds,hearonlysomesoundsorpossiblynothingat all”
- ASHA.orgWhatisHearingLoss
Whendescribinghearingloss,wegenerallylookatthreecategories:typeofhearingloss[conductivehearingloss,sensorineuralhearingloss,andmixedhearingloss.],degreeofhearing loss[Degreeofhearinglossreferstotheseverityoftheloss-rangeindecibels(dBHL).],and configurationofhearingloss[thedegreeandpatternofhearinglossacrossfrequencies(tones)].
- ASHA.orgEffectsofHearingLossonDevelopment
“Theearlierhearinglossoccursinachild'slife,themoreserioustheeffectsonthechild'sdevelopment.Similarly,theearliertheproblemisidentifiedandinterventionbegun,thelessserioustheultimateimpact.
Therearefourmajorwaysinwhichhearinglossaffectschildren:
1.Itcausesdelayinthedevelopmentofreceptiveandexpressivecommunicationskills(speechandlanguage).
2.Thelanguagedeficitcauseslearningproblemsthatresultinreducedacademicachievement.
3.Communicationdifficultiesoftenleadtosocialisolationandpoorself-concept.
4.Itmayhaveanimpactonvocationalchoices.”
SpecificEffects:Vocabulary,SentenceStructure,Speaking,AcademicAchievement,SocialFunctioning
●ASHA.orgAuditoryProcessingDisorder
“Auditoryprocessingdisorder(APD)isoftendescribedasgreaterthanexpecteddifficultyhearingandunderstandingspeecheventhoughnomeasurablehearinglossexists.Individualswithauditoryprocessingdisordersmayactasthoughahearinglossispresentwheninfact,hearingsensitivityisoftenwithinnormallimits.APDisoftenconfusedwithotherdisorderssuchasADHD,languageimpairment,learningdisabilities,socialandemotionaldelaysorcognitivedeficits.”
all.”
“Sohowdoeshearinglossdifferfromanauditoryprocessingdisorder(APD)?
APDisnottheinabilitytohear.It’stheinabilitytointerpret,organize,oranalyzewhat’sheard.Allthepartsofthehearingpathwayareworkingwell.Butpartsofthebrainarenot.”
●Hearing.comCentralAuditoryProcessingDisorder
“CentralAuditoryProcessingDisorder(CAPD)—alsoknownasAuditoryProcessingDisorder(APD)—isanumbrellatermforavarietyofdisordersthatresultinabreakdowninthehearingprocess.
Thesedisordersoccurinthehigherprocessingsectionsofthebrain.ForCAPDsufferers,thisgenerallymeansthebraincannotmakesenseofwhatourearshearbecausetheauditorysignalisdistortedinsomeway.Asaresult,oneofthebiggestproblemsexperiencedbypeoplewithCAPDisdifficultylisteningwithbackgroundnoise.”
“BecauseCAPDmakesdistinguishingspeechwithinnoisehardforchildren,theyfinditdifficulttofocus,theygetfrustrated,theirschoolworksuffersandtheygettiredfromtryingtohear.”
Hearingloss,orhearingimpairment,isaproblemwithoneormorepartsoftheearthatinterruptsthewaysoundtravelsthroughthehearingsystemuptothebrain.
[AuditoryProcessingDisorder]isnottheinabilitytohear.It’stheinabilitytointerpret,organize,oranalyzewhat’sheard.Allthepartsofthehearingpathwayareworkingwell.Butpartsofthebrainarenot.
HearinglossandAPD...havesomesymptomsincommon.Butthetreatmentoptionsareverydifferent.That’swhyit’sagoodideatoworkwithprofessionalswhoaretrainedtorecognizethedifference.
●Understood.org:Differencebetweenauditoryprocessingdisorderbeinghardofhearing
Whendescribinghearingloss,wegenerallylookatthreecategories:typeofhearingloss,degreeofhearingloss,andconfigurationofhearingloss.Withchildren,itisespeciallyimportanttodiagnoseandtreatahearinglossasearlyaspossible.Thislimitsitspotentialimpactonlearning
anddevelopment.Hearinglosscangreatlyaffectthequalityoflifeforadultsaswell.Unmanagedhearinglosscanhaveanimpactonemployment,education,andgeneralwell-being.
●ASHA.orgWhatisHearingLoss
Individualswithauditoryprocessingdisordersmayactasthoughahearinglossispresentwheninfact,hearingsensitivityisoftenwithinnormallimits.APDisoftenconfusedwithotherdisorderssuchasADHD,languageimpairment,learningdisabilities,socialandemotionaldelaysorcognitivedeficits.Itisimportanttotakeamultidisciplinaryapproachforaccuratediagnosisofthisdisorder.Membersoftheteammayincludethespeech-languagepathologist,psychologist,classroomteacher,physician,parentandtheaudiologist.
3.Deafblindness
Definition:Deafblindnessisasensory disabilitythatincludesbothdeafnessandblindness.
Characteristics:Apersonwhoisbothdeafandblindexperiencesallthecharacteristicsofthosetwodisabilities,withtheaddedcomplexitythattheabsenceofbothvisionandhearingseverelylimitsthesensoryinputpossibilitiesofthe individualtojust touch,smell,andtaste.Ofthosesenses,touchistheonlyviablemethodforcomplexcommunication.AdeafblindpersonwouldneedtolearnBrailletoaccesstext,andsignlanguagetoaccessconversations(thedeafblindpersonwouldfeelthehandsoftheotherpersonsigningintheconversation).
Demographics:Approximately35,000-50,000individualsintheUnitedStates(about0.014%)arebothdeafandblind,accordingtoresearchreferencedbyaninfopageatGallaudet University.
AssistiveTechnologiesandMethods:TranscriptsforvideooraudioconvertedtoBraille,tactilesignlanguageinterpretation.
Color-BlindnessandICT:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
Domain / Challenges / SolutionsICT / Digitaltextcannotbeseen / AscreenreadercanconverttexttoBrailleonarefreshableBrailledevice,or"printed"inaBrailleembosser.
ICT / Audio(includingthe audioportionofvideos)cannotbeheard / AtexttranscriptoftheaudiocanbeconvertedtorefreshableBraillebyascreenreader,or"printed"inaBrailleembosser.
4.Mobility,Flexibility,andBodyStructureDisabilities
ManualDexterity/FineMotorControl
●UseMyAbility:MotorManualDexterityanduseofICT
“Restrictedmanualdexteritymaybetemporary,recurringorpermanent,andmaybecausedbyawiderangeofdisabilitiesandmedicalconditions.
Limitedmotor/manualdexteritymaycausedifficultieswiththefollowing:
●UsingequipmentintheworkorlearningenvironmentProducingdemonstrationsorpresentationsinelectronicf
●Communicatingusingemail,webbrowsersorblogs;
●Storageandorganisationofdata;
●Usingcorecomputerprogrammestoproducecommondigitalinformationsuchasworddocuments(e.g.MicrosoftWord)andpresentations(e.g.MicrosoftPowerPoint);
●UsingcomputerprogrammessuchasExceltosolveproblemsoranalysedata;
●Engagingwithe-learning.”
“Impairmentsthatmayimpactonmotor/manualdexterity
●PhysicalImpairments(including,forexample,thosecausedbyastroke,neckinjury,RepetitiveStrainInjuryandothermedicalconditions)
●Dyspraxia[isaspecificlearningdifficulty(SpLD)thataffectsthebrain’sabilitytoplansequencesofmovement.]
●awiderangeofmedicalconditions,forexample,rheumatoidarthritis“
●InteractiveAccessibility5tipsimprovewebmobility/dexteritydisabilities
ByKathyWahlbinonSeptember10,2012
“Mobilityimpairmentisabroadcategoryofphysicaldisabilitiesthatincludeupperlimbandmanualdexteritydisabilities,lossoffine-motorcontrol,anddisablingconditionssuchas cerebralpalsyandcarpaltunnelsyndrome.Thedisabilitiesmaybetemporaryorpermanent;theymayrangeinseverityfrommildlossoffine-motorcontroltoquadriplegia;theymaybetheconsequenceofaging,accident,heredity,disease.Usersmayhavelimitedarmorhandmovement,usejustonehand,haveatremor,havedifficultywithfinemovements,orbeunabletoholdamouse.
Notsurprisingly,giventherangeofmobility/dexteritydisabilities,awidevarietyofassistivetechnologiesareavailablefortheseusers,includingtouchscreens,head/mouthwands,specialswitches,keyboardoverlays,one-handedkeyboards,oversizedmouseortrackball,andspeechrecognitionapplicationslikeDragonNaturallySpeaking.”
Ambulation
●DisabledWorld:
●NationalInstitutesofHealth:Energycostofambulationinhealthdisability:aliterature review
●SocialSecurityAdministration:ListingofImpairments
●JournalofPhysicalTherapyPDF:StudyofMusculoskeletalAmbulationDisability
“Motordisorders,includingjointdiseases,falls,andfractures,aretheleadingcausesofcaredependencyandamarkedlydecreasedqualityoflifeintheelderly2).”“Musculoskeletalambulationdisabilitysymptomcomplex(MADS).MADSisdefinedisan
increasedriskoffallsandisolationduetoanage-relateddeclineinbalanceandwalkingability”
●SocialSecurityAdministration:MusculoskeletalAdult
“Inability to ambulate effectively means an extreme limitation of the ability to walk; i.e.; animpairment(s) that interferes very seriously with the individual’s ability to independently initiate, sustain or complete activities. Ineffective ambulation is defined generally as having insufficient lower extremity functioning (see 1.00J) to permit independent ambulation without the use of a hand-held assistive device(s) that limits the functioning of both upper extremities.”
MuscleFatigue
●NationalInstitutesofHealth:PerceivedDisabilities
●NationalInstitutesofHealth:Disabilityandbackmusclefatigabilitychangesfollowingtwotherapeuticexerciseinterventionsinparticipantswithrecurrentlowbackpain
●CenterforDiseaseControl:GeneralInformation
●DisabilityWorld:Fibromyalgia
BodySize
●U.S.DepartmentofHealthHumanServices:ExaminingtheRelationshipsbetweenExcess BodyWeight,HealthandDisability
●DisabilityHealthBenefitsHelp:DwarfismandSocialSecurityDisabilityBenefits
“TherearemanydifferentdisordersthatcausedwarfismthataffectthousandsofAmericans.Themostcommonformisachondroplasia,atypeofskeletaldysplasia,whichaffectsabout70percentofthosewithdwarfism,theNationalLibraryofMedicineexplained.“
“Childrenwithdwarfism,inadditiontohavingproblemswiththeirskeletalsystem,mayalsosufferfromhearingloss,visionloss,heartdefects,intensepain,arthritis,andbreathingproblems,whichcanfollowthemintoadulthoodanddriveuphealthcarecostssubstantiallythroughouttheirlifetime.“
●LittlePeopleofAmerica:FAQ
“Certainlymanyshort-staturedpeoplecouldbeconsidereddisabledasaresultofconditions,mainlyorthopedic,relatedtotheirtypeofdwarfism.Inaddition,accessissuesandproblemsexistevenforhealthyLPs.Consider,forexample,thesimplefactthatmostachondroplasticadultscannotreachanautomatedtellermachine.LPAisworkingtomakecommonactivitieseasilyreachablebypeoplewithdwarfism-includinggaspumps,payphones,andATM's.”
●MayoClinic:Acromegaly
“Acromegalyisahormonaldisorderthatdevelopswhenyourpituitaryglandproducestoomuchgrowthhormoneduringadulthood.Whenthishappens,yourbonesincreaseinsize,includingthoseofyourhands,feetandface.Acromegalyusuallyaffectsmiddle-agedadults.”
“Symptomsandcauses[: Fatigueandmuscleweakness,Impairedvision,Excessivesweatingandbodyodor,Painandlimitedjointmobility.]”
“Progressionofacromegalycanresultinmajorhealthproblems.Complicationsmayinclude:[Highbloodpressure(hypertension),Cardiovasculardisease,particularlyenlargementoftheheart(cardiomyopathy),Osteoarthritis,Diabetesmellitus.]”
●TheNHSinEngland:RestrictedGrowth(dwarfism)Introduction
“Restrictedgrowth,sometimesknownasdwarfism,isaconditioncharacterisedbyshortstature.
Therearetwomaintypesofrestrictedgrowth:
●proportionateshortstature(PSS)–agenerallackofgrowth,wherethelengthofthetrunkandlimbsareinproportion
●disproportionateshortstature(DSS)–wherethelimbsareshorteroroutofproportionwithotherpartsofthebody”
“However,mostpeopledon'thaveanyotherseriousproblems.Theycanoftenlivearelativelynormallifeandhaveanormallifeexpectancy.”
BodyShapeorForm
●SSNDisabilityBenefitsHelp:AmputationandSocialSecurityDisability
●NEADS:MakingExtra-CurricularActivitiesInclusive
“Aphysicaldisabilityisonethataffectsaperson'smobilityordexterity.Apersonwithaphysicaldisabilitymayneedtousesomesortofequipmentforassistancewithmobility.Italsoincludespeoplewhohavelostlimbsorwho,becauseoftheshapeoftheirbody,requireslightadaptationstobemadetoenablethemtoparticipatefullyinsociety.“
●SSNDisabilityBenefitsHelp:MusculoskeletalSystem
“disabilityclaimsformusculoskeletaldisordersrelateprimarilytohowthedisabilityaffectsyourabilitytomove,performtasks,andconcentrateonajob.”
●SSNDisabilityBenefitsHelp:ApertSyndrome
“ApertSyndromeandDisabilityBenefitsAlsoknownasAcrocephalosyndactylyTypeI,Apertsyndromeisararegeneticdisorderthatcausesearlyandabnormalfusionofbones,especiallyinthehead,hands,andfeet.InfantswithApertsyndromearebornwithcranialandfacialdeformities.Otherbirthdefectsmaybepresentaswell.IntellectualdeficitsaresometimespresentandchildrenandadultswithApertsyndromeoftenexperienceothercomplications,includinghearingloss,sleepapnea,andchronicearandsinusinfections.
IndividualswithApertsyndromeusuallyrequiremultiplesurgeriesininfancyandearlychildhood.Theyoftenneedspecializedattentionandcarethroughoutchildhoodandsometimesintoadulthood.”
●SSNDisabilityBenefitsHelp:ClubfootDeformity
“ClubfootDeformityandSocialSecurityDisability
Clubfootisabirthdefectwitharelativelyhighincidencerate.Inthoseaffectedbythecondition,oneorbothfeetaremalformedatbirth,turninginwardanddown,affectingtheirabilitytostand,walk,balanceandperformotheressentialfunctions.Thoughtreatmentsareavailable,includingexercise,physicaltherapy,useofbracesorcasts,andevensurgeryinsomecases,thereisnocureforthecondition.
Somewhosufferfromclubfootdeformitymayexperiencelimitationsonrangeofmotionandpronouncedpainforyearsfollowingeventhemostsuccessfultreatments.Incaseswheretheconditionisleftuntreated,itcanworsenovertime,resultinginsignificantdisability.”
●AustralianGovernment:AustralianInstituteofHealthandWelfare:Arthritis,osteoporosisand othermusculoskeletalconditions
“Rheumatoidarthritisisanauto-immunediseasecausingchronicinflammationofthejoints.Itmostcommonlyaffectsthehandjointsandcanleadtodeformitiesofthehands.
Osteoporosisisaconditionwherethereisaprogressivelossofbonedensityanddecreaseinthestrengthoftheskeletonwitharesultantriskoffracture.”
5.CognitiveDisabilities
Cognitiveandintellectualdisabilitiesmayresultfromavarietyofconditionsorinjury.Thesedisabilitiesmaybe acomponentofother disabilitiessuchasclosedtraumatic braininjury ormayoccurontheirown.Whendisabilitiesoccurtogetherthechallengescanbeincreasedorbecomemorecomplicatedbytheadditionofemotionalandphysicalreactionsspecifictothechallengesuchasperformanceanxietyorfatigue.
Givingindividualswithcognitive andintellectualdisabilitiesadditionaltimeiscriticaltotheirsuccessattaskssuchasreading,calculating,writingorspeaking.Thereareassistivetechnologies(AT)whichmaybecriticaltothesuccessindoingthesetasksincludingscreenreaders,calculators,speech-to-textprogramsandcaptioning,spell-checkers,grammarcheckers,picturedictionaries,writingtemplates,organizationalaids,andcolorcodingsuchashighlighters.
Manyofthesetechnologieshavebecomecommonplaceandareusedbymanypeoplewithandwithoutdisabilitiesorareusedby peoplewithdisabilitieswedidnotknowwouldbenefitfromthemwhentheyweredesigned.ScreenreadersandCaptioningaretwosuchATwhichareusedbypopulationsforwhichtheyoriginaldesignerhadnoideawouldbenefit–cognitiveandintellectualdisabilities.
IntellectualDisabilities
AAIDD:DefinitionofIntellectualDisability
“Intellectual disabilityis a disability characterized by significant limitationsin bothintellectual functioningand in adaptivebehavior,which coversmany everydaysocial andpracticalskills. Thisdisabilityoriginatesbefore the ageof 18.
“Intellectual functioning—also called intelligence—refersto general mental capacity, suchas learning,reasoning, problem solving, andsoon.
“Adaptive behavior isthecollection of conceptual, social, and practical skillsthat are learnedandperformed bypeople in theireveryday lives.
- Conceptual skills—language and literacy; money, time, and numberconcepts; and self-direction.
●Social skills—interpersonal skills, social responsibility, self-esteem, gullibility,naïveté (i.e.,wariness), social problem solving, and the ability to followrules/obey lawsand to avoid beingvictimized.
- Practical skills—activities of daily living (personalcare), occupational skills, healthcare,travel/transportation, schedules/routines,safety, use of money, useof the telephone.”
- Memory
- W3C:COAGUserResearch: Memory
ReadingandDyslexia
- NationalInstituteforLearningDevelopmentCanada:LearningDisabilities
- NationalInstituteofNeurologicalDisordersandStroke:Dyslexia
Readingdisabilitiesmayincludespecificinabilitytoperceivetextortoprocessthemeaningofwords,phrasesandideas.Thedisabilitymaybetheresultofa congenitaldifference,injury,delayeddevelopment,neurologicalorphysicaldisability.Somespecificreadingdisabilitieshavebeenidentifiedandarerecognizedbyprofessionalsbydiagnosis,suchasDyslexia.Oftenthe diagnosisofa LearningDisability willincludecomponentsofareadingimpairment.
Dyslexiaisabrain-basedtypeoflearningdisabilitythatspecificallyimpairsa person'sabilitytoread.Theseindividualstypicallyreadatlevelssignificantlylowerthanexpecteddespitehavingnormalintelligence.Althoughthedisordervariesfrompersontoperson,commoncharacteristicsamongpeoplewithdyslexiaaredifficultywithphonologicalprocessing(themanipulationofsounds),spelling,and/orrapidvisual-verbalresponding.Inindividualswithadult onsetofdyslexia,itusually occursasa resultofbraininjury orinthecontextofdementia;thiscontrastswithindividualswithdyslexiawhosimplywereneveridentifiedaschildrenoradolescents.Dyslexiacanbeinheritedinsomefamilies,andrecentstudieshaveidentifiedanumberofgenesthatmaypredisposeanindividualtodevelopingdyslexia.
ReadingDisabilitiesandICT:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
Domain / Challenges / SolutionsICT / Oftenperceivewordsasfloatingandnotina line. / Canuseaspecialfontdevelopedfor Dyslexiawhichweightsthelettersdownandmakessimilarfiguresappeardifferently
Maybegrantedadditionaltimetocompletetasks
ICT / Oftenperceivewordsdifferentlythanotherssuchasseeingpbdqasthesameletter. / Canchangethefont,contrastoraddanunderlinetotexttokeepwordsinline.
Maybegrantedadditionaltimetocompletetasks
ICT / Oftenrequireadditionaltimetoreadandprocesscontent. / Canextendtimeoutsandreturntothesamelocationonthepage.
CanuseascreenreadertogetcontentinanauditorymethodtoreinforcewhatisbeingseenCanusescreenreaderswhichhighlightthewordor phrase beingreadtoassistwithtracking.
Can use enhanced visible focus indicators to keep track of their position on the page.
Can use special programs or dictionaries which present words with pictures.
May be granted additional time to complete tasks
ICT / Oftenhavetheburdenofdecipheringcontentfromthewayitispresented. / Mayapplyacustomstylesheet
ICT / MayhavedifficultysolvingproblemspresentedthroughsecurityfeaturessuchasCAPTCHA / Abilitytochangethetypeofproblempresented
ICT / Mayhavedifficultyprocessingcontentthroughvisualmeans / CanuseascreenreadertogetcontentinanauditorymethodtoreinforcewhatisbeingseenMaybegrantedadditionaltimetocompletetasks
ICT / Mayhaveahardtimespellingwordscorrectly / Canuseaspellingandgrammarchecker
- MathandComputation
Understood:DyscalculiaUnderstood:Dysgraphia
Dyscalculia:Dyscalculia
NationalInstituteforLearningDevelopmentCanada:LearningDisabilities
Mathandcomputationaldisabilitiesimpactaperson’sabilitytolearnandcommunicatemath.ThecharacteristicsofMathLearningDisabilitiesincludeaninabilitytounderstandarithmeticandhowto calculate(Dyscalculia) andaninability todrawor copy figuresandgraphs(Dysgraphia).AswithReadingDisabilities,MathDisabilitiesmaybeofacongenitalorigin;resultfromaninjuryorothereventssuchasstrokeoraging.AnxietyisoftencoupledwithMathLearningDisabilitywhichcanfurthercomplicatethechallenges.
MathandICT:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
Domain / Challenges / SolutionsICT / Inabilitytodistinguishrightfromleftingraphicimages / Canreaddata ina datatable ortextdescriptionasanalternativetographicrepresentationsofdatawhenanalternativeisprovided.
Maybegrantedadditionaltimetocompletetasks
ICT / Inabilitytocopygraphs,figuresanddiagrams / Canusespeech-to-texttoverbalizeinstructionsforcompletinghomeworkandtestquestionswhenthequestionsaredesignedtoaccessibilityguidelinesandtext-to-speechassistivetechnologycanaccesscontent.
May be granted additional time to complete tasks
ICT / Inabilitytoperformcalculations / Canuseanaccessibilityaccommodationlinktoareferencesheetwithcommonequationswhenprovided
CanuseanonscreencalculatorasanaccommodationMaybegrantedadditionaltimetocompletetasks
- AttentionDeficit
NationalInstituteofNeurologicalDisordersandStroke:AttentionDeficitHyperactivity Disorder
“Attention-deficit/hyperactivitydisorder(ADHD)isabraindisordermarkedbyanongoingpatternofinattentionand/orhyperactivity-impulsivitythatinterfereswithfunctioningordevelopment.
- Inattentionmeansapersonwandersofftask,lackspersistence,hasdifficultysustainingfocus,andisdisorganized;andtheseproblemsarenotduetodefianceorlackofcomprehension.
- Hyperactivitymeansapersonseemstomoveaboutconstantly,includingsituationsinwhichitisnotappropriatewhenitisnotappropriate,excessivelyfidgets,taps,ortalks.Inadults,itmaybeextremerestlessnessorwearingothersoutwiththeiractivity.
- Impulsivitymeansapersonmakeshastyactionsthatoccurinthemomentwithoutfirstthinkingaboutthemandthatmayhavehighpotentialforharm;oradesireforimmediaterewardsorinabilitytodelaygratification.Animpulsivepersonmaybesociallyintrusiveandexcessivelyinterruptothersormakeimportantdecisionswithoutconsideringthelong-termconsequences.”
FoundationforPeoplewithLearningDisabilitiesUK:AttentionDeficitHyperactivity Disorder(ADHD)
“ManypeoplewithADHDalsoexperienceadditionalproblemssuchassleepdisorders,andmayhavefurtherlearningdifficultiescausedbytheirdifficultywithholdingattention.
ADHDhasnoeffectonintelligence,butsomepeoplewithalearningdisabilitymayalsohaveADHD.”
“Howitaffectspeople
TheeffectsofADHDonchildrencanbeverydisruptiveatbothschoolandhome.Whiletheirintellectmaybenormaloradvanced,morethanhalfofchildrenwithADHDhaveadditionalspecificlearningdifficulties,suchasdyslexia.
PeoplewithADHDmayexperiencelowself-esteemorunderachievementduetothedifficultiesinvolvedinmanagingtheirsymptoms.
Theyarealsomorelikelytobedepressed,anxious,orobsessive,andtheymayhaveproblemswithspeech,languageandcoordination.
PeoplewithADHDneedhighlevelsofstimulation,sooftenfindworkinginaconstantly-movingenvironmentbeneficial.
Whenproperlymotivatedorworkingonsomethingofparticularinteresttothem,theyareabletomaintainahighattentiontodetailandaconsistentworkethic.”
“HowmanypeoplehaveAttentionDeficitHyperactivityDisorder?
Itisestimatedthattheconditionaffects2-5%ofschool-agedchildrenandyoungpeople.Itisuptofourtimesmorecommoninmalechildrenthaninfemalechildren.”
Learning
LearningDisabilityUK:Averybriefguidetolearningdisability
“Peoplewithalearningdisabilityareaverydiversegroupwithawiderangeofabilities.Apersonwitha‘mildlearningdisability’mayliveintheirownhouse(orinahousesharedwithotherpeople),work,andraisechildren.Theywillprobablyneedadviceandsupportinthesetasksfromtimetotime.“
“Bycontrast,someonewitha‘severeorprofoundlearningdisability’willprobablybeunabletousespeech,maybeincontinentandphysically-disabled,andneedhelpwithsimpletaskslikeeatinganddrinking.“
“Learningdisabilityisassessedbyacombinationofintelligencetestsandmeasuresof‘adaptivebehaviour’(i.e.aperson’sabilitytocarryouteverydaytasks).IntheUK,thethresholdforlearningdisabilityisusuallysetatanIQofbelow70.Butpeoplewithalearningdisabilitydonotfallintoafewdiscretegroups,andtheirIQscoresmaynotreflecthowwelltheycopewithlife.Noraretheirabilitiesfixedforever.Peoplewithalearningdisabilityareabletocarryonlearningnewskillsthroughoutadulthood.”
NationalInstituteofNeurologicalDisordersandStroke:LearningDisabilitiesInformation Page
“Learningdisabilitiesaredisordersthataffecttheabilitytounderstandorusespokenorwrittenlanguage,domathematicalcalculations,coordinatemovements,ordirectattention.Althoughlearningdisabilitiesoccurinveryyoungchildren,thedisordersareusuallynotrecognizeduntilthechildreachesschoolage.Researchshowsthat8to10percentofAmericanchildrenunder18yearsofagehavesometypeoflearningdisability.”
Wikipedia:Learningdisability
“Whilelearningdisability,learningdisorderandlearningdifficultyareoftenusedinterchangeably,theydifferinmanyways.Disorderreferstosignificantlearningproblemsinanacademicarea.Theseproblems,however,arenotenoughtowarrantanofficialdiagnosis.
Learningdisabilityontheotherhand,isanofficialclinicaldiagnosis,wherebytheindividualmeetscertaincriteria,asdeterminedbyaprofessional(psychologist,pediatrician,etc.).Thedifferenceisindegree,frequency,andintensityofreportedsymptomsandproblems,andthusthetwoshouldnotbeconfused.Whentheterm"learningdisorder"isused,itdescribesagroupofdisorderscharacterizedbyinadequatedevelopmentofspecificacademic,language,andspeechskills.Typesoflearningdisordersincludereading(dyslexia),mathematics(dyscalculia)andwriting(dysgraphia).
Wikipedia:Dyslexia
“Dyslexia,alsoknownasreadingdisorder,ischaracterizedbytroublewithreadingdespitenormalintelligence. Differentpeopleareaffectedtovaryingdegrees.Problemsmayincludedifficultiesinspellingwords,readingquickly,writingwords,"soundingout"wordsinthehead,pronouncingwordswhenreadingaloudandunderstandingwhatonereads.”
Wikipedia:Dyscalculia
“Dyscalculiaisdifficultyinlearningorcomprehendingarithmetic,suchasdifficultyinunderstandingnumbers,learninghowtomanipulatenumbers,andlearningfactsinmathematics.Itisgenerallyseenasaspecificdevelopmentaldisorder.
DyscalculiacanoccurinpeoplefromacrossthewholeIQrange,often,butnotalways,involvingdifficultieswithtime,measurement,andspatialreasoning. Estimatesoftheprevalenceofdyscalculiarangebetween3and6%ofthepopulation.AquarterofchildrenwithdyscalculiahaveADHD.”
Wikipedia:Dysgraphia
“Dysgraphiaisadeficiencyintheabilitytowrite,primarilyhandwriting,butalsocoherence.Dysgraphiaisatranscriptiondisability,meaningthatitisawritingdisorderassociatedwithimpairedhandwriting,orthographiccoding(orthography,thestoringprocessofwrittenwordsandprocessingthelettersinthosewords),andfingersequencing(themovementofmusclesrequiredtowrite).Itoftenoverlapswithotherlearningdisabilitiessuchasspeechimpairment, attentiondeficitdisorder,ordevelopmentalcoordinationdisorder.”
Language
Wikipedia:ListofLanguageDisorders HASALanguage-BasedLearningDisabilities
“Language-basedlearningdisabilityisatermthatmaybeusedtocoverseveraldifferenttypesoflearningdisabilitiesinwhichimpairedlanguageabilityisthecommoncharacteristic.
Theinitialimpactoccurswithdelaysinspokenlanguagethatmayaffectspeech,butmorecommonlyaffectstheabilitytounderstandwordsandselectappropriatevocabularytoexpressideas.Oftentimesthisearlydifficultywillleadtounevendevelopmentoflanguageabilitiesthatarecriticalforacademiclearningandhigheremergentliteracyskillsincludingreading,spellingandwriting.”
NIDCD:ApraxiaSpeech
“Apraxiaofspeech,alsoknownasverbalapraxiaordyspraxia,isaspeechdisorderinwhichapersonhastroublesayingwhatheorshewantstosaycorrectlyandconsistently.Itisnotduetoweaknessorparalysisofthespeechmuscles(themusclesoftheface,tongue,andlips).Theseverityofapraxiaofspeechcanrangefrommildtosevere.”
“Therearetwomaintypesofspeechapraxia:acquiredapraxiaofspeechanddevelopmentalapraxiaofspeech.Acquiredapraxiaofspeechcanaffectapersonatanyage,althoughitmosttypicallyoccursinadults.Itiscausedbydamagetothepartsofthebrainthatareinvolvedinspeaking,andinvolvesthelossorimpairmentofexistingspeechabilities.Thedisordermayresultfromastroke,headinjury,tumor,orotherillnessaffectingthebrain.Acquiredapraxiaofspeechmayoccurtogetherwithmuscleweaknessaffectingspeechproduction(dysarthria)orlanguagedifficultiescausedbydamagetothenervoussystem(aphasia).
Developmentalapraxiaofspeech(DAS)occursinchildrenandispresentfrombirth.Itappearstoaffectmoreboysthangirls.Thisspeechdisordergoesbyseveralothernames,includingdevelopmentalverbalapraxia,developmentalverbaldyspraxia,articulatoryapraxia,andchildhoodapraxiaofspeech. “AutismSpectrumDisabilities
AutismSpeaks:WhatisAutism
“Autismspectrumdisorder(ASD)andautismarebothgeneraltermsforagroupofcomplexdisordersofbraindevelopment.Thesedisordersarecharacterized,invaryingdegrees,bydifficultiesinsocialinteraction,verbalandnonverbalcommunicationandrepetitivebehaviors.WiththeMay2013publicationoftheDSM-5diagnosticmanual,allautismdisordersweremergedintooneumbrelladiagnosisofASD.Previously,theywererecognizedasdistinctsubtypes,includingautisticdisorder,childhooddisintegrativedisorder,pervasivedevelopmentaldisorder-nototherwisespecified(PDD-NOS)andAspergersyndrome.
ASDcanbeassociatedwithintellectualdisability,difficultiesinmotorcoordinationandattentionandphysicalhealthissuessuchassleepandgastrointestinaldisturbances.SomepersonswithASDexcelinvisualskills,music,mathandart.”
CommunicationSpeechPathology:AutismandAsperger’sSyndrome
AutisticSpectrumDisordersarecharacterizedbythreemainareasofdifficulty–impairedcommunicationskills,impairedsocialinteractionsandrestrictiveorrepetitivebehavioursorinterests.IndividualswithAutismoftenhavethefollowingdifficultieswiththeircommunication:
- Delayed/disorderedlanguageskills
- Lackofjointattention
- Limitedeyecontact
- Lackofunderstandinganduseofnon-verbalcommunicationincludinggesturesandfacialexpressions
- Echolaliaoftenintheformofrepetitionofphrasesfromtelevision
- Limitedplayskillsparticularlyimaginativeplay
- Difficultiesinconversationsincludinginitiatingandsustainingconversationsandtopicmaintenanceinconversations
- Overlyliteralinterpretationoflanguageanddifficultieswithabstractorfigurativelanguage
ChildrenwithAutismareusuallydiagnosedpriorto3yrsofageoftenduetosignificantdelayinthedevelopmentoflanguageskills.Autismisaspectrumdisordermeaningthatthelevelofdifficultycanvarygreatlyfromseveretomildacrossdifferentindividuals.Atthesevereendofthespectrum,thechildmayhavesignificantintellectualimpairmentandbenon-verbal.Atthemildendthechildmaybequitehighfunctioning.
IndividualswithAsperger’sSyndromealsohavedifficultieswithcommunication,socialskillsandrepetitiveorrestrictivebehavioursbutexperiencenosignificantdelayintheacquisitionofearlylanguageskills.Infact,theyoungchildwithAsperger’smaybedescribedashavingprecociouslanguageandalargevocabulary(eventhoughitmaynotbesemanticallywelldeveloped).
IndividualswithAsperger’sdonothaveimpairedcognitiveskillsandmaypresentwithaboveaverageintellect.”
Wikipedia:Autism
“Socialcommunicationdisordersmayincludeproblemswithsocialinteraction,socialcognition,andpragmatics.Asocialcommunicationdisordermaybeadistinctdiagnosisormayoccurwithinthecontextofotherconditions,suchasautismspectrumdisorder(ASD),specificlanguageimpairment(SLI),learningdisabilities(LD),languagelearningdisabilities(LLD),intellectualdisabilities(ID),developmentaldisabilities(DD),attentiondeficithyperactivitydisorder(ADHD),andtraumaticbraininjury(TBI).Otherconditions(e.g., psychological/emotionaldisordersandhearingloss)mayalsoimpactsocialcommunicationskills.InthecaseofASD,socialcommunicationproblemsareadefiningfeaturealongwithrestricted,repetitivepatternsofbehavior.”
“Autismisaneurodevelopmentaldisordercharacterizedbyimpairedsocialinteraction,verbalandnon-verbalcommunication,andrestrictedandrepetitivebehavior.Parentsusuallynoticesignsinthefirsttwoyearsoftheirchild'slife.Thesesignsoftendevelopgradually,thoughsomechildrenwithautismreachtheirdevelopmentalmilestonesatanormalpaceandthenregress.Thediagnosticcriteriarequirethatsymptomsbecomeapparentinearlychildhood,typicallybeforeagethree.”
6.SpeechDisabilities
Speechdisorderscanrangefrommildslurredspeechtothecompleteinabilitytomovethemouthtospeak.Theabilitytophysicallyspeakmaybecompletelyunrelatedtotheperson'slanguagecapabilities,inthesensethatthepersonmaybeabletoread,write,andunderstandlanguage,eveniftheperson'smouthstructureorneuromuscularconnectionsdonotallowthepersontoarticulatewordswiththemouth.Speechdisordersmaybecausedbyoraside-effectofunderlyingdisabilities.Aperson'sspeechmayimprove,mayremainstable,ormayprogressivelygetworseovertime.IndividualsbornwithCerebralPalsymaybeabletoimprovespeechcapabilitiestoapointwheretheyarestableovertheirlife-time.Yet,theirlanguagecapabilitiesinthewrittenwordmayprogressivelyimprovewithinstructiontoapointwheretheindividualbecomesanexceptionalwriter.
Withsomedisabilities,AutismSpectrumandspecificSpeech-Languagedisabilities,theindividualmaylearnscriptsormimicothersandtherebycanfunctionquite normallyinsomesocialsituations.Onacomputer,withassistivetechnologyandenoughtime,theindividualmaybeabletofunctionand succeedindependently.
ALS,Parkinson’s,MSandAlzheimer’sdiseaseareonlyafewofmanyconditionswhichmaycauseaperson’sabilitytospeakorperformtasksinvolvinglanguagetodeteriorateovertime.Theimpactsofthisdeteriorationcanbedevastating.Programslikewordpredictionandauto-completesearchescanbeusedtoextendtheindividual’sabilities.AssistiveTechnologysuchasscreenpointers,sipandpuffcontrolscanalsobeusedasthediseaseprogressestohelptheindividualcommunicateandinteractintheirenvironment.
SpeechandLanguage:ExamplesofAssistiveTechnologiesandAdaptiveStrategies
